PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_1814_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family SBP
Protein Properties Length: 1003aa    MW: 111766 Da    PI: 7.139
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_1814_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.42.8e-40153230178
                                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT------- CS
                                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrr 74 
                                          +Cqve+C+adls+ak+yhrrhkvC++hska+ +lv  ++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrr
  cra_locus_1814_iso_4_len_4203_ver_3 153 VCQVEDCRADLSNAKDYHRRHKVCDMHSKATRALVGSVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNRRRR 226
                                          6************************************************************************* PP

                                          S--- CS
                                  SBP  75 kkqa 78 
                                          k+++
  cra_locus_1814_iso_4_len_4203_ver_3 227 KTHP 230
                                          *976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.4E-32147215IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.111151228IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-37152232IPR004333Transcription factor, SBP-box
PfamPF031101.6E-28154227IPR004333Transcription factor, SBP-box
SuperFamilySSF484036.84E-9727880IPR020683Ankyrin repeat-containing domain
SMARTSM00248360772803IPR002110Ankyrin repeat
Gene3DG3DSA:1.25.40.202.4E-7777878IPR020683Ankyrin repeat-containing domain
CDDcd002042.06E-8777874No hitNo description
SMARTSM00248130821851IPR002110Ankyrin repeat
SMARTSM00248730861890IPR002110Ankyrin repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1003 aa     Download sequence    Send to blast
MEAKLGGKAL HFCGPVVSDM KAVGKRSIEW DLNDWNWDGD LFTAAPLTSV PSDCRSRQFF  60
PLGSEVPTNT RVSNSFSSGS DELVSGTDKG KRELEKRRRL VDVEDEECVD EVGSLNLKLG  120
GQVYPIAEGD AEKWECKSGK KSKVVGPSSN RAVCQVEDCR ADLSNAKDYH RRHKVCDMHS  180
KATRALVGSV MQRFCQQCSR FHVLQEFDEG KRSCRRRLAG HNRRRRKTHP ESTVSGATAN  240
DDQGSNYLLI SLLRILSNIH SSNNSDQPKD QDLLSHLLRS LANLAGGVNE RILSGHLPAS  300
PDVQNAGTSN GAPAKDHPNQ SIWQSATASV SESAQEEGLL QNSSPSQSTL VFTTKERTPA  360
NANTFGSISG KTILNTFDLN NAYDDSQDCM ENLQNSDAPI DLGKALPPGC PLWLHQDPRK  420
YSPAQTSGNS GSPSSQSPSS SSEAQSRTDR IVFKLFGKDP SDFPLLVRKQ ILDWLSHSPT  480
DIESYIRPGC VILTIYLRMD NSMWEELCYD LSSSLKKLLD TSMDSFWRTG WIYARVRHHV  540
AFVYDGNIVL DTTLSRKSLR SCRILNIKPI AVCASDKVEF LVKGLNICRP TTRLHCALEG  600
KYLVRDHADV MGGAESFNEQ AAEIQTLNFN CAIKNFNGRG FVEVEDQGLS SSFFPFIVAE  660
KDVCSEICSL ETIIEAAENA DSIDRELERL VARNQALEFI HELGWLLHRC QSEIRLGQNN  720
PNCDLFPFKR FRWLVEFSIE HDWCAVVKKL LNILFYRIVD AGQYSSTEDA LLDIGLLHRA  780
VRRNSRSMVE LLLRFHPDGN LTESQLSKEK YLFRPDLKGP GGLTPLHIAA GRDGSEHVLD  840
ALTDDPGMVG VEAWRSASDS TGLTPYDYAC LRGHYSYTHL VQKKIKKKSA SQHVVVEMPP  900
GSLLDNSTNQ KLVADDMLGK VGGLETGKLE VRPNHMMMNC RQCEQKLAYG KTRRSLSIYR  960
PTMLSMVAIA AVCVCVALLF KSSPEVFCVF RPFRWESLEY GSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-29148227584squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19599KRRRL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015076164.10.0PREDICTED: squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A068TRT40.0A0A068TRT4_COFCA; Uncharacterized protein
STRINGSolyc05g053240.2.10.0(Solanum lycopersicum)